PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MELO3C023633P1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Cucumis
Family MYB
Protein Properties Length: 188aa    MW: 21647.5 Da    PI: 10.1381
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MELO3C023633P1genomeMELONOMICSView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding57.33.6e-18552148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT+eEd  l ++v+ +G g+W+++ar+ g++Rt+k+c++rw++yl
   MELO3C023633P1  5 KGPWTAEEDSVLFNYVNCHGEGRWNAVARCTGLKRTGKSCRLRWLNYL 52
                     79********************************************97 PP

2Myb_DNA-binding47.83.3e-1558101146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      rg+ T +E++l+++++ ++G++ W++Ia++++ gRt++++k++w++
   MELO3C023633P1  58 RGNITLQEQLLILELHFRWGNR-WSKIAQYLP-GRTDNEIKNYWRT 101
                      7899******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129424.637156IPR017930Myb domain
SuperFamilySSF466891.83E-31299IPR009057Homeodomain-like
SMARTSM007172.2E-14454IPR001005SANT/Myb domain
PfamPF002495.4E-16552IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.4E-22659IPR009057Homeodomain-like
CDDcd001671.34E-11752No hitNo description
PROSITE profilePS5129417.20957107IPR017930Myb domain
SMARTSM007173.4E-1357105IPR001005SANT/Myb domain
PfamPF002493.8E-1458101IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.8E-2160106IPR009057Homeodomain-like
CDDcd001672.65E-778101No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 188 aa     Download sequence    Send to blast
MDVRKGPWTA EEDSVLFNYV NCHGEGRWNA VARCTGLKRT GKSCRLRWLN YLRPSVRRGN  60
ITLQEQLLIL ELHFRWGNRW SKIAQYLPGR TDNEIKNYWR TRVQKQAKQL NCDVNSKQFR  120
DAMRYVWMPR LLERIQASTD STATTVDVIQ PSHPPLELTQ SSPSGSSWVN PHVAPTTSSS  180
DSIFDQV*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C1e-25210724128MYB TRANSFORMING PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankFJ0369010.0FJ036901.1 Cucumis sativus clone CU20C06 myb-like transcription factor Myb5 mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008461407.11e-138PREDICTED: transcription factor MYB108-like
SwissprotQ9LDE11e-74MY108_ARATH; Transcription factor MYB108
TrEMBLA0A0A0K5V31e-118A0A0A0K5V3_CUCSA; Uncharacterized protein
STRINGLOC_Os07g48870.12e-86(Oryza sativa Japonica Group)
STRINGORGLA07G0213800.12e-86(Oryza glaberrima)
STRINGBGIOSGA026430-PA3e-86(Oryza sativa Indica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF87534125
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G49620.11e-76myb domain protein 78